SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009240 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009240
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.56e-35
Family SCAN domain 0.0000545
Further Details:      
 
Domain Number 2 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 738-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.48e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 682-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 850-907
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 178-238
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 10 Region: 626-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.25e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 11 Region: 906-963
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 12 Region: 948-1000
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 13 Region: 565-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 14 Region: 290-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.98e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 15 Region: 794-851
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-17
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009240   Gene: ENSMODG00000007446   Transcript: ENSMODT00000009421
Sequence length 1007
Comment pep:novel chromosome:BROADO5:1:669738928:669811619:1 gene:ENSMODG00000007446 transcript:ENSMODT00000009421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAARQNFRWYQYPEVAGPQEALIQLRELCSQWLRPEIHTKEQILELLVLEQFLTILPEDI
RIWVKAQHPTNSKEVVNLVEDLTQTLEERGENYRKITGWKLGISGNSKIKLASLIFPFNS
LAMNTHDASLFQVEEREKERMAPELLTLRSQVSSPSLMPGHICHTFANTDIRCHNRMLLK
ESVTFKDVAVDFTEEEWERLDSDQRDLYLTVMLENYRNLVFLGLPVSKPELIFQMDQEEE
SRILEREKLCKNNQYEEDFGHFSNFMQYDLHNEERVYKYNECVKPCNESISITQHQGIHT
EEKRYKCNECGKAFSRSTFLTQHQSIHTGERHYKCNECSKAFSQRTHLVQHQRIHTGERP
YECNDCGKAFSQRSHLVQHQRNHTGEKPYDCNECGKAFRDSSSLIRHQIIHTGEKTYECL
ECGKAFSHSSTLTQHQRTHTGEKPYECKTCGKAFSHSSSLSQHQRIHTGEKPFECNECGK
AFSNSSSFTKHQRIHTGEKRYKCSECGKAFSQSTHVIQHQRIHTGEKPYECNQCGKAFSE
NSSLTRHQIIHSGEKPHECNECGKTFRHSSSLNQHQRIHTGEKPYECSTCRKTFSCRSSL
CKHKRLHIEKNQTGEKLYKCNECGKAFGRSTLLIQHQSIHTGEKHYKCNECGKAFTQRTH
LVQHQRIHTGEKPYECNDCGKTFRYRSNLTQHQRIHTGMKPYKCNECGKAFRESSSLIRH
QIIHTGEKTYECNKCGKTFIHSSSLSQHQRIHTGEKPFECNECGKAFSSSSSFIKHKRIH
TGEKRYKCSECGKAFSQSTHAIQHQRIHTRKKPFEYNEYGIAFSNSSSFIKNQRINIGEK
RYKCGECGKSFSQRTHAIQHQRIHTGEKPFECNDCGKAFSNSSSFIKHQRIHTGEKRYKC
SECGKAFTQSTHAIRHQRIHTRNKPFECHECGKTFSQRTHLIQHQRIHTGERPYECNDCG
KTFRHRSSLTQHQRIHTGEKPYECNICRRTFRSRSSLTKHQRIHTEE
Download sequence
Identical sequences F7DVV8
ENSMODP00000009240 13616.ENSMODP00000009240 ENSMODP00000009240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]