SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009249 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009249
Domain Number 1 Region: 160-294
Classification Level Classification E-value
Superfamily Acid proteases 1.83e-42
Family Retroviral protease (retropepsin) 0.0000705
Further Details:      
 
Domain Number 2 Region: 38-169
Classification Level Classification E-value
Superfamily dUTPase-like 3.66e-23
Family dUTPase-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009249   Gene: ENSMODG00000025326   Transcript: ENSMODT00000009430
Sequence length 312
Comment pep:novel chromosome:BROADO5:X:22384635:22385644:1 gene:ENSMODG00000025326 transcript:ENSMODT00000009430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQTPAPIVAPPKLPPNSSPGTGKRDVGLPREPLSSSLTRATAGSAGLDLCASTTRILTPE
EGPIVLPTGKFGPPPPGMFFLVIGRALTTLQGVVVHPTLVNNDYKGEIKIIIESPHGPVT
IPAGRRLAQALPFPMIGNFPVVAHTRDPSSPGSSNIYWVQQLTESQPTLQLKIEGKTFTG
LLDTGADSTVISQAHWPRSWPLQPSSTHLSGIGQVQDTLQSSKVLTWQDTEGNRGTTRPY
VVAGLPVNLWGRDILTQMRLLMVSPSDPVTTMMLKSGYLPGKGLGKREQGLPHPISFRPH
KDRKGLGLQSFS
Download sequence
Identical sequences F7DVL9
ENSMODP00000009249 ENSMODP00000009249 13616.ENSMODP00000009249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]