SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009299 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009299
Domain Number 1 Region: 36-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.85e-40
Family SCAN domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 256-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-25
Family Classic zinc finger, C2H2 0.002
Further Details:      
 
Domain Number 3 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.39e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009299   Gene: ENSMODG00000007492   Transcript: ENSMODT00000009480
Sequence length 358
Comment pep:known_by_projection chromosome:BROADO5:2:262952243:262975468:1 gene:ENSMODG00000007492 transcript:ENSMODT00000009480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATHLNSEALEEQEDLFIVKEEAHYWEQESSLQHNHSTSEVFRQHFRQLCYQETSGPREA
LTRLRELCHQWLRPEMHTKEQILEFLVLEQFLTILPKDLQTWVQDHHPENGEEAVTVLED
LEREIDEPAYQGPANVHRQETLFEEIAPKGTSRTSTESLSIHLNPRKTQLKWKSWELYPL
QKNDDETKTENVGLIQKEETSEDMESLGDIYGRLSGHISWDPIFRQAFEPEDRLEWQQEN
LEGKRRHKCDECGKGFSHSSDLSKHKRTHTGEKPYKCDECGKAFIQRSHLIGHQRVHTGV
KPYKCKECGKDFSGRTGLVQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTNKFY
Download sequence
Identical sequences F7CQI3
ENSMODP00000009299 ENSMODP00000009299 XP_001374123.2.35504 XP_007483477.1.35504 XP_007483478.1.35504 XP_007483479.1.35504 XP_007483480.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]