SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009386 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009386
Domain Number 1 Region: 3-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000012
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009386   Gene: ENSMODG00000007563   Transcript: ENSMODT00000009570
Sequence length 52
Comment pep:novel chromosome:BROADO5:6:249816402:249816560:1 gene:ENSMODG00000007563 transcript:ENSMODT00000009570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSNRSVRSVN
Download sequence
Identical sequences F7FZX6
ENSMODP00000009386 13616.ENSMODP00000009386 ENSMODP00000009386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]