SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009575 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009575
Domain Number 1 Region: 400-574
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 8.5e-31
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.059
Further Details:      
 
Domain Number 2 Region: 159-233,333-396
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.07e-29
Family Poly(A) polymerase, PAP, N-terminal domain 0.081
Further Details:      
 
Domain Number 3 Region: 35-137
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000149
Family Canonical RBD 0.0052
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000218
Family Classic zinc finger, C2H2 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009575   Gene: ENSMODG00000007710   Transcript: ENSMODT00000009764
Sequence length 857
Comment pep:novel chromosome:BROADO5:5:300431596:300439483:-1 gene:ENSMODG00000007710 transcript:ENSMODT00000009764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMEPDVEALPRGGFRCCLCHVNTANRPSLDAHLKGKKHLRLEELRATRRAQGLRSVFV
SGFPRGLDPTQLSEYFQAFGPVASVVMDKDKGVFAIVEMGDTGARDAVLAQAQHVLSGHR
LRIRPREQKEFQTPAPKAPKGAPPDDQQLTQALAEAPDVEAQMVKLVGLRELSEAERQLR
GLVVMLMQEVFTEFFPGCVIRPFGSSTNGFGVHGCDLDLFLDMGSLEGPQRDPKAPASPA
LDSALASPLDPQALASTPASPVDSQAPASPQDSETPTSSLAPLTPDSALASEALASPQSL
PPVSPIQEELREKDLGEAWELVGALKGEEGEGEAMLELVGSVLRGCVPGVHSVRTVPSAR
RPVVKFCHRPSGLHGDISLSNRLALYNSRFLNFCCELDRRVRPLVYTLRRWAQGRGLTGS
GPLLSNYALTLLVIYFLQTRDPPVLPPLTKLTQMAGEEEQVEVDGWDCSFPQEVSCLEPS
TNTEPLDALLAQFFACVSSWELQGSLLSLREGRPLPIAEGLPPGLWGGLRVGPLNVQDPF
DLSHNVAANVTSRVAGRLQNCCRDSANYCRSLQFQRRSPRGRDWGLLPLLQPSSANSLLS
VTPIPLPLAPFSQLCAAITQVLEEMLGCQVEQSSKRPRPEGDGEERPQGGPSKRLRLERE
EERKGSLQDQATEGRQDGAAVEEMMLAADGREDQPSATGDVGQLGEQPQRLWQHVIERKE
KELENPGTEEMETAQGGEEAGPGMTPTWLCALWHRVWLGRRRLRRQLQQQAKGEISWLQA
EARVTQELIAQESKKQGKEAEPPPPLLTFTASVSPSGQFFTLTQLQDPQGLFPDLHHFLQ
GFLPRTLRGILGCEKGD
Download sequence
Identical sequences F7EVE8
XP_001366127.1.35504 ENSMODP00000009575 ENSMODP00000009575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]