SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009759 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009759
Domain Number 1 Region: 42-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.79e-37
Family SCAN domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 355-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 536-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 713-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.1e-19
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 6 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-18
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 752-796
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000161
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 8 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000145
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 9 Region: 223-263
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000157
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009759   Gene: ENSMODG00000007851   Transcript: ENSMODT00000009950
Sequence length 811
Comment pep:known_by_projection chromosome:BROADO5:2:262041833:262232927:1 gene:ENSMODG00000007851 transcript:ENSMODT00000009950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRESRETTSLPTPIHPPQEQEGLLIVKVEEEDCTWMQENSPPDMETFNQRFRQYQYYEA
SGPREALSQLRVLCCEWLRPEMHTKEQILELLVLEQFLAILPGQLQAWVREHHPESGEEA
VVLLEELQRDFDEQGEEVAAYPEVPLQEMMPQRMIQESLNIQFQPMDTQPESGPQKPLSL
EANALPASQIPAIPQKGNLRDQQMAAAFHMTGAQTLVKIEDVADVAVSFILEEWGHLDET
QKDHSRNDRQENYETITSVDYEPRNEIVKQEISEEAESLWMTQGIIEKHDSQDQEYEELP
NYGGHLERQQENYAMDKPKQSPSHKRGFRDIIDINKKQTMRVEKGHKCNDCGKFFLQASN
FIQHRRIHTGEKPFKCNECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQH
QTVHSGERPYGCNECGKSFGRHSHLIEHLKRHYREKTRPCGEKRGKNMKVLKKKISDATE
TYREISAKIQKDVTQGQELREGHEHEDWLDRQQGKLTGMILGKLPSQERSFREIIDIHKR
PPTGERPHKCNECGKSFIQSAHLIQHQRIHTGEKPFKCDECGKSYNQRVHLTQHQRVHTG
EKPYQCHLCGKAFRVRSHLVQHQSVHTGEKPFQCNECGKSFGRRSHLAGHLRLHYREKPN
QCRECGENFHQYNSLIEHQMIHRGQHPHEDGNCEKAYWNLSLIENKEMLMEEKPFKCDMC
GKTFCYSSHLVQHHRMHTGEKPYECDICGKNFGQRSHLTQHQRSHSCKKPHQCNECGRAF
ALKSHLNQHQRIHTGIIKWRNSMETGTISRK
Download sequence
Identical sequences F7ET75
ENSMODP00000009759 ENSMODP00000009759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]