SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009779 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009779
Domain Number 1 Region: 157-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 45-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 101-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-17
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009779   Gene: ENSMODG00000007848   Transcript: ENSMODT00000009971
Sequence length 317
Comment pep:novel chromosome:BROADO5:6:109250424:109251545:1 gene:ENSMODG00000007848 transcript:ENSMODT00000009971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIHTGEKPYKCTDCGKSFSKRAHLTPHQRIHTGEKPYECNECEKAFRDSSSLINHQRIHT
GEKPYECKGCRKAFSRKTNLTVHERIHTGERPYECHECGKTFSQSSSLTQHQRIHTGQKP
YKCTECGKAFCRHTHLTQHQRIHTGEKPYECSKCEKSFSDRSSLSQHQRIHTGEKPYECK
ECGKAFSQRTQLKKHQRIHTGEKPYECHECRKTFIQKSGLSYHQRMQSEGNNYICNECGK
AFSRNSCLIYHQFIHDRKKLYECKVCGKIFSQNSSLMEHQFIHMGKKSFVCNECGKSFFL
SKSLKRHERIHMGKEIS
Download sequence
Identical sequences F7EBD4
13616.ENSMODP00000009779 ENSMODP00000009779 ENSMODP00000009779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]