SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009815 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000009815
Domain Number - Region: 54-66
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0112
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009815   Gene: ENSMODG00000007890   Transcript: ENSMODT00000010007
Sequence length 540
Comment pep:known_by_projection chromosome:BROADO5:8:242831517:242833262:-1 gene:ENSMODG00000007890 transcript:ENSMODT00000010007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRQDLYNPDPNLEPPMYVPPPSYRSPPHQNTNPHFLNEVPHFQCGGHMQQQQQPPPPPQQ
PPPPPPQSGNQYGASICPPQGLPGPLQHTDACDTSVQYIPFSDPRIRHIQVTHHQDLSKD
AKLLEILCNTGSSVCQGLARVQEQDGGAFFHPESLVPPTKSKHDPTTYASSLGWLQTAPP
PDREICALPDQRDNCVLSEQQPDKESSGQQGAQGRVSSQTPQWENTCETVTKLKTFQTGI
STKKSSKKKVNETVFCLVSVPVKSGPHLPDTDRNNNDLKLRADKKNGDKSGALQEQSLLS
MSSTDLELQALTGSMASKTELQKQEPGGPQMYKQTNDLRFIHPMKHRELRYSGSWPGDQY
RDQQTQTTITQDSQISEFLPAKKMEDQPNVLPIPKSSEPSALETLKPTVSLPNDWKLRTD
TCNLKGQMYFSPSSNSAFSKTASSMIQGPISKACQSQPYRSSADINERDTKPVFKGQIVK
GESNAPCNSKELFGQFLLKPVSRRPWDVISQLESFNKELQEQEESSSNSSIDGETAEREQ
Download sequence
Identical sequences F6ZGB9
13616.ENSMODP00000009815 ENSMODP00000009815 ENSMODP00000009815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]