SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009841 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009841
Domain Number 1 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-26
Family KRAB domain (Kruppel-associated box) 0.00079
Further Details:      
 
Domain Number 4 Region: 212-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 426-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-18
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 7 Region: 175-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000431
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009841   Gene: ENSMODG00000007910   Transcript: ENSMODT00000010033
Sequence length 485
Comment pep:novel chromosome:BROADO5:1:669103948:669114393:1 gene:ENSMODG00000007910 transcript:ENSMODT00000010033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESVTFKDVAVNFTREEWRNLDPGQRDLYREVMLENYRNLVSLGYHISKPNMISQLEKGKE
PWMVESGTSRCICSDRETRPEAKDSTPKEGISKENSNQEGITMNGLWSSKLGKPWECDSQ
SNSQQGIHERQVKLLEVTQKKNFTGKKFPKSNKFRVSYSLNSATTPQEISVGENCHKCDM
CKKNFKENSGLIKHKRTCSGKKRFECNECDKAFSQRAHLIQHQRIHTGERPYECNECGKA
FRRTIDLTQHQRIHTGEKPYECNQCERAFSQRAHLIQHQRIHTGERPYECSECSKAFSWS
THLTEHQKIHTGEKPYECNECGKAFRKSTDLNRHQRIHTGEKPYECSECEKAFSQRAHLT
QHQRIHTGEKPYECNECGKTFRWSTHLTQHQRIHTGEKPYECNKCGKTFRRSTELTQHQR
IHTGEKPYKCSECEKAFSCRTHLIHHKSTHSGEKPYGCNECGKTFNRSSSLTQHQRIHTG
EESQE
Download sequence
Identical sequences F7GIJ8
ENSMODP00000009841 ENSMODP00000009841 13616.ENSMODP00000009841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]