SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009843 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009843
Domain Number 1 Region: 307-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 367-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 248-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-17
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009843   Gene: ENSMODG00000007909   Transcript: ENSMODT00000010035
Sequence length 638
Comment pep:known_by_projection chromosome:BROADO5:5:249242999:249273407:1 gene:ENSMODG00000007909 transcript:ENSMODT00000010035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAQINRDSQGMTEFPGGGMEAQHVTLCLTEAVTVADGDNLENMEGVSLQAVTLADGST
AYIQHNSKDGKLMDGQVIQLEDGSAAYVQHLPIPKSTGDSLRLEDGQAVQLEDGTTAFIH
HASKDSYDQSALQAVQLEDGTTAYIHHTVQVPQSDTILAIQSDGTVAGLHTGDATIDPDT
ISALEQYAAKVSIDGSDSVTGAGIIGENEQEKKMQIVLHGHGTRVTAKSQQSGEKAFRCD
YDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRTHTGEKPYRCQ
EDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYYCT
EPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCN
HCGKTYKQISTLAMHKRTAHNDTEPIEEEQEAFFEPPPGQGEDVLKGPQITYVTGVEGED
VVSAQVATVTQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDA
VISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMAHQAHGHHLVTTEARPLTLV
ATSNGTQIAVQLGEQQSLEEAIRIASRIQQGETPGLDD
Download sequence
Identical sequences F7GIJ1
ENSMODP00000009843 XP_007497142.1.35504 ENSMODP00000009843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]