SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009851 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009851
Domain Number 1 Region: 47-138
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-40
Family SCAN domain 0.00007
Further Details:      
 
Domain Number 2 Region: 247-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-20
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 285-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009851   Gene: ENSMODG00000007917   Transcript: ENSMODT00000010043
Sequence length 336
Comment pep:known_by_projection chromosome:BROADO5:2:261758458:261777115:-1 gene:ENSMODG00000007917 transcript:ENSMODT00000010043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKVREASMLVSQIPDEQDRILIVKMEEEEIHTCEQEPSLHWNNCYSPETFRQRFRQFG
YQDSPGPREALSQLREFCHLWLRPEMHTKEQILELLVLEQFLAILPKELQTLVQKHHPEN
GEEAVTVLEDLEREIDGPGEQVSFHRQSQEEMVLQGADQESLSLQVQPMVNQLKWASWEL
HTLRRSGDDTRVENVELAPKQISSDIESHGSISGTLNMNVPQILKFRESCESDGKFKRRQ
GTPSRKKQYKCDECGKNFSQSSALILHQRIHSGEKPYECDECAKAFSRSSILIQHRRIHT
GEKPYICHECGKAFSQSSNLFRHKRRHNKEKILTVS
Download sequence
Identical sequences F7GID4
ENSMODP00000009851 ENSMODP00000009851 XP_007483449.1.35504 XP_007483450.1.35504 XP_007483451.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]