SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009861 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009861
Domain Number 1 Region: 7-15,232-239
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000785
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 
Domain Number 2 Region: 757-819
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000935
Family Ubiquitin-related 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009861   Gene: ENSMODG00000007927   Transcript: ENSMODT00000010053
Sequence length 1222
Comment pep:known_by_projection chromosome:BROADO5:3:170896394:170931331:1 gene:ENSMODG00000007927 transcript:ENSMODT00000010053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPPPPPPPPPPPPPPPEAPAAAAAAAAAAQGGLAKRKDRRILSGNCPDPKCQARLFFP
ASGSASIECTECGQRHEQHQLLGVEEVTDPDVVLHNLLRNALLGVTGAPKKNTELVKVLG
LSNYHCKLLSPILARYGMDKQTGRAKLLRDMNQGELFDCALLGDRAFLIEPEHVNTVGYG
KDRSGSLLYLHDTLEDIKRANRSQECLIPVHVDGDGHCLVHAVSRALVGRELFWHALREN
LKQHFQQHLARYQALFHDFIDAAEWEDIINECDPLFVPPEGVPLGLRNIHIFGLANVLHR
PIILLDSLSGMRSSGDYSATFLPGLIPAEKCTGRDGHLNKPICIAWSSSGRNHYIPLVGI
KGAALPKLPMKLLPKAWGVPQDLIKKYIKLEEDGGCVIGGDRSLQDKYLLRLVAAMEEVF
MDKHGIHPSLVADVHQYFYRRTGVIGVQPEEVTAAAKKAVMDNRLHKCLICGALSELHVP
TEWLTPGGKLYNLAKSTHGQLRPDKNYSFPLNNLVCSYDAGKDVLIPDYSLSNLTACNWC
HGTSVRRVRGDGSVVYLDGDRTNTRSTGGKCGCGFKHYWEGKEYDNLPEAFPITLEWSGR
VVRETVYWFQYESDVSLNSNVYDVAMKLVTKHFPGEFGSEILVQKVVHTILHQTAKKNPD
DYTPVNIDGAHVQRVEDVQHGQDLESQLPTKIILTGQKTKTLHKEELNMSKTERTIQQNI
TEQASIMQKRKTEKLKQEQKAQPRTVSPSIIRDGPSSAPATPTKAPYSPVSTKEKKIRIT
TNDGRQSMLTLKPSTTYFELQESIAREFDIPPYLQCIRYGFPPKELMPPKAGMEKEPVPL
QHGDRITIEILKGKEEGGQPGAAHSAHTVKHEDIAVTSKISSKELQEQTDKEMYSLCLLA
TLMGEDIWSHAKGLPHLFQQGGVFYNIMKKTMGMADGKHCTFPHLPGKTFVYNASEDRLE
LCVDAAGHFPISPNVEDSVREALSQVRAETTSRSRESSPSHGLLKLGSGGVVKKKSEQLH
NVTAFQGKGHSLGTASSSPLLDQRAREGPVVRKHSTGTDFAASSAKPDPSVFTAPPGNSE
LIRIAPGVVTMRDSRQLDPNLIEAQRKKLQEMVSSIQASMDRHLRDQNTEQSPTDFPQRK
VEVVSSSAKSGSFQAGLPESFPVTGGTEHLNAETTGGNVASAMGTTFATRSKAQKGNSVD
EPEEMDSQDAEMTNATEPMDHS
Download sequence
Identical sequences F7GI69
XP_001379004.2.35504 ENSMODP00000009861 13616.ENSMODP00000009861 ENSMODP00000009861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]