SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009896 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009896
Domain Number 1 Region: 201-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000541
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009896   Gene: ENSMODG00000007952   Transcript: ENSMODT00000010088
Sequence length 266
Comment pep:known_by_projection chromosome:BROADO5:5:300549994:300550791:-1 gene:ENSMODG00000007952 transcript:ENSMODT00000010088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHSSPTSSTEAVPTGYFSPSLGAAPGEPPAPLEVGPENLGVVGPRGPSGPMEGFYPPPPV
PVPVPAPGEAEPVQVKVEAIVISDEEPEGLEERPRAPEGLFPPGSGCRSRYAPAEAFEEA
AVTAASGAGGPGLEEVGPADHFLAPDSHLPYHLLAGPGHYHPGLVTPPPPAPSSLHESLY
LPPEYEVAPGGFGVFTEDVPTCKTCGKTFSCSYTLRRHATVHTRERPYECRYCLRSYTQS
GDLYRHIRKAHNEDLAKRSKQDPEAA
Download sequence
Identical sequences F7G8T8
ENSMODP00000009896 ENSMODP00000009896 13616.ENSMODP00000009896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]