SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009928 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009928
Domain Number 1 Region: 52-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.16e-36
Family SCAN domain 0.0000904
Further Details:      
 
Domain Number 2 Region: 367-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-21
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 326-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-17
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009928
Domain Number - Region: 238-288
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000144
Family KRAB domain (Kruppel-associated box) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009928   Gene: ENSMODG00000007971   Transcript: ENSMODT00000010120
Sequence length 500
Comment pep:known_by_projection chromosome:BROADO5:2:261629366:261645360:1 gene:ENSMODG00000007971 transcript:ENSMODT00000010120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGSKDASALDNQISKEQLELLAVKMEEKKECRYVQKSGLQRNSPSNWELSRQFRNFCY
QETPGPREALSQLRELCCQWLRPESCTKEQILEMLVLEQFLSILPDELQTWVLNQHPETG
EEAVSLLEDLEKEFDESKQQVPASIQGKEGLWKKMTPLSSAQESQWNIQLQPVETKLKCE
SQEFYSLQKRALQVPACFTKETCKDLETAFFLPSPRLQNLFRHFSERKLSPNSDVRHIQG
LLKMEGKSLSLTPDEWGQLELSEMILCRGTNQKNFEDKISLDNKLSMDIRESIQKQELPK
KFHLPCQLSSEVSRDLRGGKSGEQESRLEKKQRNTTRRKQYKCEECGKYFAQSSGLSKHR
RIHTGEKPYECDACGKAFIGSSALVIHQRIHTGEKPYECEECGKAFSHSSDLIKHQRIHT
VPNSLPSPPPPTIKKSRNTPYTCKMLPMFWGREQKTKPRKRKRKKCFSQYFEFISALSPS
IFYLELVEMSPGPEAMSSEA
Download sequence
Identical sequences F7DQP1
ENSMODP00000009928 ENSMODP00000009928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]