SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009964 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000009964
Domain Number - Region: 104-209
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.011
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009964   Gene: ENSMODG00000008004   Transcript: ENSMODT00000010156
Sequence length 506
Comment pep:novel chromosome:BROADO5:1:355619526:355655374:-1 gene:ENSMODG00000008004 transcript:ENSMODT00000010156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEARKKMAAVAAEAAATAASPGEGGAGEAEPEMEPIPGSEAGAEAGTDPLLVTATEALVL
DEADSKPAPQADEPPLQPPGESARKPEEEGEATTAPQGPEPSTPPPPPEEGKEPAPEEPP
PPPQPQSAVPALVPPAGGDSAVAQLIPGSEVRVTLDHIIEDALVVSFRLGEKLFSGVLMD
LSKRFGPHGIPVTIFPKREYKDKPEAMQLQSRSFQEGTEIKCDMNGAGPDDHSPIQPPEP
SLAKSLWTSKPPPLFHEGAPYPPPLFIRDTYNQSIPQPPPRKIKRPKRKMYREEPTSIMN
AIKLRPRQVLCDKCKNSVVAEKKEIKKGGNASDSSKYDDNKKRRNESVTTVNKKLKTDHK
MDGKNQNESQKRNAVVKVSNIAHSRGRVVKVSAQANTSKAQLSTKKVLQSKNMDHAKARE
VLKMAKEKAQKKQSETSTSKNAHSKVHFTRRFQNTSSGSLPPRLRLKPQRYRNEENDSSL
KAGLEKMRSGKMAPKPQSRCTSTRSA
Download sequence
Identical sequences F7CLI7
ENSMODP00000009964 ENSMODP00000009964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]