SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010011 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010011
Domain Number 1 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.39e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 44-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 100-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 7 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.83e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 8 Region: 492-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 9 Region: 16-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000577
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 10 Region: 287-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000365
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 11 Region: 203-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000405
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010011   Gene: ENSMODG00000001620   Transcript: ENSMODT00000010203
Sequence length 546
Comment pep:novel chromosome:BROADO5:1:668943915:668945552:1 gene:ENSMODG00000001620 transcript:ENSMODT00000010203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIPIGENLHKNHEYTKAFWNTHMANHQTVHNREKPYECNYCGKAFRSSSYLIQHQRTHTG
EKPYECNDCGKTFRWSSQFTQHQRLHSGVKLYKCNDCGKVFPNRTYLTEHQRIHTGEKPF
ECNDCGRTFRWSSQFTQHQRLHTGVKLFKCNDCGKVFPNKTYLSEHQRIHTGEKPYECND
CGKTFRWSSQLTLHQRTHTGEKPYKCNNCERAFRSKLHLTRHQRLHTGEKPYECHECGEA
FRWSSQLTVHRKIHTGDAPYKCDDCGKVFCWSSQFIEHQRIHTGEKPYKCNDCGKAFGWL
SQFTRHLRIHTGEKTYKCYECGKTFLDSTYLTEHQRIHTGEKPYECNDCGKVFHWSSYLT
QHQKTHTGEKPYKCNECGKNFCWRSQFTQHQRQHTGLKLYKCNDCGKSFLNKTYLTQHRR
THTREKPYKCNECGKNFRWSSQFTQHQRLHTGVKLYPCNDCGKSFLSNTYLTQHKRTHTR
EKPYKCNDCGRTFRWSSQFTQHQRLHTGVKLFKCNDCGKVFPNKTYLSEHQRIHTGEKPF
ECTDCG
Download sequence
Identical sequences F6ZA26
ENSMODP00000010011 13616.ENSMODP00000010011 ENSMODP00000010011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]