SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010186 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010186
Domain Number 1 Region: 488-654
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 2.04e-65
Family MgsA/YrvN C-terminal domain-like 0.0000206
Further Details:      
 
Domain Number 2 Region: 221-454
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.41e-44
Family Extended AAA-ATPase domain 0.00092
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010186
Domain Number - Region: 68-76
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0126
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010186   Gene: ENSMODG00000008193   Transcript: ENSMODT00000010382
Sequence length 657
Comment pep:known_by_projection chromosome:BROADO5:3:346933662:346965649:1 gene:ENSMODG00000008193 transcript:ENSMODT00000010382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSGPEDDPFLSQLHQVQCPVCQQALPAAHINAHLDRCLLLHPAGLSEPDEEESLGSSE
PGRRPNSPPPPPPPPPLGSCKRRRLSGGSLRLPPATPTGDSSDGEPEDPDGPGPPDGRDP
YDRCPSPCAGAHLIPAFVRGPSGSPLLRRKVSGKRPVAAAASASATASSSAAADDDEEDR
EDWEASAPSTAAFRESSGHLGPGRAQPRTPAREEIWQKLVGKPLADKMRPATLQEYIGQN
KVVGQETLLRSLLESNEIPSLILWGPPGCGKTTLAYIIANNSKKNSMRFVTLSATSAKTS
DVRDVIKQAQNEKNFFKRKTILFIDEIHRFNKSQQDTFLPHVECGTVTLIGATTENPSFQ
VNAALLSRCRVIVLEKLSAEAMKTILMRAVSSLGLRVLDQGRPTDSHDDNLPLVYIEDKA
VNTLAYLCDGDARTGLNGLQLAVQAKLGSRKPFCKKTVQNYSGESVLITENDIKEGLQRS
HILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIG
LADPSALTHAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYNAYNNVKACLRNHQ
GPLPPVPMHLRNAPTRLMKDLGYGKGYKYNPAYKDPVEQEYLLEELRGIDFFKQKRC
Download sequence
Identical sequences F7DJS2
ENSMODP00000010186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]