SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010221 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010221
Domain Number 1 Region: 52-416
Classification Level Classification E-value
Superfamily ARM repeat 1.73e-98
Family Diap1 N-terninal region-like 0.0000526
Further Details:      
 
Domain Number 2 Region: 614-1004
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.27e-97
Family Formin homology 2 domain (FH2 domain) 0.00000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010221   Gene: ENSMODG00000008221   Transcript: ENSMODT00000010419
Sequence length 1079
Comment pep:known_by_projection chromosome:BROADO5:1:260513575:260746753:1 gene:ENSMODG00000008221 transcript:ENSMODT00000010419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRKRSGRFSFVFCCFQSNDPPEITYRLRNDSNFALQMMEPAFPMPPVEELDVMFSELV
DELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLLV
LEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESQIHTSL
IGCIKALMNNSQGRAHVMAHSESINVIAQSLSTENIKTKVAVLEIMGAVCLVPGGHKKVL
QAMLHYQKYASERTRFQTLTNELDKSTGRYRDEVNLKTAIMSFINAVLSQGAGVESLDFR
LHLRYEFLMLGIQPVIDKLREHENLTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSAT
QMFELTRKRLTHSEAYPHFMSILYHCLQMPYKRSGNTVQYWLLLDRVVQQIVIQNDKGQD
PDSTPLENFNVKNVVRMLVNENEVKQWKEQAERMRKEHSDLQQKLEKKERECDAKTQEKE
EMMQTLNKMKEKLEKESSEHKQVKQQVADLTAQLQELSRRAVCASVPGGPSPGAPGSPFP
PPTPGSILAPPPPPPLPSGLHLPPPPPPPLPPGGPPPPPGPPSLGGIMPPPGAPLGLALK
KKNIPQPTNALKSFNWSKLPENKLDGTIWNEIDDLKVFKNLDLEDLERTFSAYQRQQDFF
INSNSKQKETDAIDDTLSSRHKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDE
QEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHYQQRLQSLYF
KKKFAERVAEVKPKVEAIRIGSEEVLKSTALRQLLEVVLAFGNYMNKGQRGNAFGFKLSS
LNKIADTKSSIDKNITLLHYLITIVEKKYPKVLNLNEELRDIPQAAKVNLTELDKEINTL
RSGLKAVEAELEYQKSQLSQPGDKFVSVVSQFIAVASFSFSDVEDLLTEAKELFTKAVKH
FGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKRKEEEERRARMEAQLKEQREKERK
ARKTKENCEEGGEFDDLVSALRSGEVFDKDLSKLKRNRKRITNPVTDSSRERPVTKLNF
Download sequence
Identical sequences F6ZY74
XP_007473021.1.35504 XP_007473022.1.35504 XP_007473024.1.35504 XP_016279453.1.35504 XP_016279454.1.35504 ENSMODP00000010221 ENSMODP00000010221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]