SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010246 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010246
Domain Number 1 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.48e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 165-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 556-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 612-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 308-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 500-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 654-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-18
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 10 Region: 127-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000261
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 11 Region: 351-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000414
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 267-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000398
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 13 Region: 91-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000546
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010246   Gene: ENSMODG00000027963   Transcript: ENSMODT00000010444
Sequence length 719
Comment pep:novel chromosome:BROADO5:2:253239028:253260555:1 gene:ENSMODG00000027963 transcript:ENSMODT00000010444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNSREVAALVPQTLDPEKDEIYQTLTLTPRQEILTRTEWKPKRFQLQSVTDETDCVTP
EPHLLLQNGGETRTRNEETTMKQEILDDDYQLLHTEEQPPMFNEYGNSFSHNSALVGLKV
FQTKEEAYDCQKCGESFISMAHLTQHQSLHTGLGRYECYECGKRFNRSYDLIRHQVIHTG
ERPFSCNECGKTFKRKSTLIEHQNIHTGEKPYRCNKCGRAFRQNTGLIEHQKIHTVEKPY
KCNECEKTFSNSSSLLQHQIAHTGEKPYKCDECGKAFINSSSLLRHHNIHKGGKLCKCEE
CGKTLSNSLSFFQHLKIHTGEKPYKCNDCGKGFICNSYLVEHKRIHTGERPYVCKECGKA
FRRSWNLTEHQRSHNSEKSYRCTECGKAFKNSSSLFHHQRIHSGGKPFDCNECGMAFRRK
SRLIDHQRVHTGEKPYECDKCMKSFSHRSQLLEHMRTHTGEKHYECNQCGKSFTRNSGLL
RHQKIHTGEKPYECNQCGKAFSNSSCLIEHERIHTTEKPYKCSECGKAFCKKSYLTGHQV
IHSKEKPYRCNECGKSYSRRFRLVEHQRIHTGEKPYECSECGKTFSRSALFIKHQIIHTK
EKPYICDQCGKAFSLRKHLVQHQRIHTEEKPFKCNECGKAFRHKSTFHDHQKTHTGDKPC
KCNECGKSFNRIFHLIEHQRTHTKEKPYECSECGKSFSRSSVFIKHQKIHAKEKLDSCN
Download sequence
Identical sequences F6ZXF2
ENSMODP00000010246 ENSMODP00000010246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]