SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010254 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010254
Domain Number 1 Region: 296-356
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000000392
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010254   Gene: ENSMODG00000008255   Transcript: ENSMODT00000010452
Sequence length 586
Comment pep:known_by_projection chromosome:BROADO5:3:175407698:175459782:-1 gene:ENSMODG00000008255 transcript:ENSMODT00000010452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSY
YAPSIGFPYSLGEAAWSTAGDPPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLG
QHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSK
VPGINSIEQGMTGLKIGGDMTAAVTKTVGSALSSTGMTSIAANSVPPVSSSAPKPTSWAA
IARKPAKPQPKLKPKGNVGIGGPAVPPPPIKHNMNIGTWDDKGSVVKAPPTQPVLPPQTI
IQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQQQQPQQLQNRWVAPRN
RGVGFNQNNGAGSENFGLGVVPVSSSPSGVEVHPVLEKLKAINNYNPKDFDWNLKNGRVF
IIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEM
KSVVDYNAYAGVWSQDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVP
LEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRRERNRNKQ
Download sequence
Identical sequences F6ZX60
ENSMODP00000010254 ENSMODP00000010254 13616.ENSMODP00000010254 XP_001368230.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]