SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010322 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010322
Domain Number 1 Region: 128-222
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.95e-38
Family Forkhead DNA-binding domain 0.0000383
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000497
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010322   Gene: ENSMODG00000008307   Transcript: ENSMODT00000010522
Sequence length 482
Comment pep:known_by_projection chromosome:BROADO5:3:345100801:345107861:1 gene:ENSMODG00000008307 transcript:ENSMODT00000010522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEGGQQPQQQQQQQQQQQQQRLPPPPAPLQRPCSPAPGALQSVLMSQPPPSSSSAAAA
AALETTSSSSSSSASSASSSSSSSSSASSAACKNASGSGGSSGSGGGGGGGGGGSGSKKA
SSGLRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHN
LSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRMV
SGLGFGASLLPQGFDFQAPPSAPLGCHGQGGYGGLDMMPGGYDSSAGAPGHSHPHHHHHH
VPHMSPNPGSTYMASCPVTTGAGVGAAGGGGGGGGGGTGGGGGEYGPDSSSSPVPSSPAM
ASAIECHSPYTSPAAHWSPPGSSPYLKQPPALTPTSNPAAPAGLHSSMSSYSLEQSYLHQ
NAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHHQSVCQDIKPC
VM
Download sequence
Identical sequences F7FGY5
ENSMODP00000010322 ENSMODP00000010322 XP_001378770.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]