SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010503 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010503
Domain Number 1 Region: 282-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-16
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 2 Region: 315-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000446
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010503   Gene: ENSMODG00000008446   Transcript: ENSMODT00000010709
Sequence length 370
Comment pep:known_by_projection chromosome:BROADO5:4:180676903:180679182:1 gene:ENSMODG00000008446 transcript:ENSMODT00000010709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAVLRNDSLQAFLQDRTPSASPELVKHSPLALLAATCSRIGQPGAAAPPDFLQVSYD
PTLGSPSRIFHPWTTDMPAHSPGGLPPPHPSLGLTPQKNHLQPSFGAAHELPLTPPADPS
YPYEFSPVKMLPSSMAALPASCPPAYLSPNPGPEDIPWWSIPQAGAGAGGPGVPGGGVPG
GCSGGHPGHHAPRFPAAATAAAAAAAALQRSLVLGHSDFAQYQSQIAALLQTKSPLAATA
RRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHVPGCGKVYGKTSHLKAHLRWHTGERPFVC
NWLFCGKSFTRSDELQRHLRTHTGEKRFACPECGKRFMRSDHLAKHVKTHQNKKLKAGEA
GVKREDTRDL
Download sequence
Identical sequences F7GF09
ENSMODP00000010503 ENSMODP00000010503 13616.ENSMODP00000010503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]