SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010589 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010589
Domain Number 1 Region: 617-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 558-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 192-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 109-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-22
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 5 Region: 53-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-21
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 342-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 408-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 503-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.59e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 295-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 11 Region: 2-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 238-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 13 Region: 659-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 14 Region: 156-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000108
Family Classic zinc finger, C2H2 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010589   Gene: ENSMODG00000008516   Transcript: ENSMODT00000010795
Sequence length 715
Comment pep:novel chromosome:BROADO5:2:522415838:522419467:1 gene:ENSMODG00000008516 transcript:ENSMODT00000010795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENLMKHQTTQTGEKPFECNQCGNAFDTEEDLSTHQKTHTGEKSFKCNECGKGFSQRENLM
KHQTTHTGEKPFKCNQCGNTFHTEEDLRTHQKTHTGEKSFKCNECGKGFSQRENLMKHQT
THTGEKPFKCNQCGNTFHTEEDLRTHQKTHTGEKSFKCNECGKGFSQRENLMKHQTTHTG
EKPFKCNQCGNTFHTEEDLRTHQKTHTGEKSFKCNECGKGFSQRENLMKHQTTHTGEKPF
ECNECGKAFGEKRTLSRHQKTHSGVKPFECNECKKAFSRRTDLIIHQRIHTGEKIHQKTH
SGLKPLKCNECKKTFNQRTSLIIHQRTHTGEKPFKCNECGKAFTQKAILINHKRLHTGEK
PFTCNECGKGFIQKVVLINHQRTHTREKPFTCSVSGKIYSNSKTAKKKPFKCNVCGKAFS
EKNYLITHQRTHTGEKPFTCNECGKAFSRRTNLISHQRIHTREKPFKCSECEKAFSRKKT
LKKHQRTHSGDKSFECNVCKKNFSHRGHLVSHQRTHIGEKHFTCSECGKVFSRRTALIRH
HKTHSGEKPFKCTECGKSFRESETLKRHQRIHTGEKPFECNICGKAFTQRGHMDHLITHQ
RTHTGEKPFVCDECGKAFSRRTILITHQRTHTGVKPFECKECRKAFSQRGHLIYHQRIHT
GEKPFDCNECGKGFSWRANLLTHRRTHIETKPFSCKECGKTFSERQDLYRHKRTH
Download sequence
Identical sequences F7FFZ0
ENSMODP00000010589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]