SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010603 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010603
Domain Number 1 Region: 351-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 239-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 185-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.78e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 2-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-21
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 9 Region: 126-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.81e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 88-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000161
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 11 Region: 564-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000427
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010603   Gene: ENSMODG00000008532   Transcript: ENSMODT00000010810
Sequence length 607
Comment pep:novel chromosome:BROADO5:2:522295782:522303361:-1 gene:ENSMODG00000008532 transcript:ENSMODT00000010810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLTQEPVAFRDVAVDFSWEEWQHLAPAQRSLYRAVMLENYKNLVSVEQEDIACETEIVI
SFNQYLLSTSPNMLHSFIQIVRIHIRKKSFAYNEYKRDFTWRANLIFHQRINTEEKPLDC
SECGKAFTRKEHLTRHQRTHFGKIPFACNECGKSFKHWSNLFIHQRTHTKKKPFSYNKCG
KANHQREELKNHQKIHKGEKPFACNECGKAFRYSSSLIIHKRTHTGEKPFACNECGKSFS
EGAVLKRHQRIHTGEKPFACNDCGKSFSDSVVFRSHQRIHTGEKPFECKECGKAFSQRGY
LITHQRTHTGEKPFACNECGKGFRNRINFITHQRTHIGEKRFACNECGKPFSRREHLIRH
QRTHTGEKPFACNECGKAFRHRSHLITHQRTHTGEKPFACNECGKAFSQSEILKSHQRIH
IGEKPFTCTECGKAFRHRSSLFIHQRTYFGEKHFACDECGKAFSESEVLKSHQRMHTGEK
PFECNECGKAFRHRGHLINHQRTHSGEKLFTCSECGKAFSENELLKIHQRIHTGEKPFEC
NECGKGFSRREHLINHERIHTGEKHFACHECGKSFIQRGNLITHQRTHTKEKPFAYSELR
IKYSEVI
Download sequence
Identical sequences F7DHF2
13616.ENSMODP00000010603 ENSMODP00000010603 ENSMODP00000010603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]