SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010637 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010637
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 595-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 651-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 693-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 9 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-20
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 10 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 11 Region: 203-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000339
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010637   Gene: ENSMODG00000023594   Transcript: ENSMODT00000010844
Sequence length 775
Comment pep:novel chromosome:BROADO5:4:403072854:403088029:1 gene:ENSMODG00000023594 transcript:ENSMODT00000010844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGTQSPASQGSITFQDVTVAFTQEEWRLLQPSQKELYREVMLEISQSLLSVGLPVARE
DLIYFQEGKAPWILEQKGPRNSYSDAVTRFKVKETIANLSISVEESCQLRFMNDGLCDVD
FRELCESDTTVDKNSKKPCQSDEVGESFTQFSDLNHCKNTTSRNDCFQYSKYRDCFTEQV
ELNQAHEKPPEMQIYQSSQQKMTFSLRSNLSRHQKNYCGKSLSTYNEERKTFSQNSKIRN
HQKIHTRKKPYECNEGVATITHHSSVPYHPRFYIGMKTHVCNQCGKAFRWNSDLVRHQKI
HTGEKPYKCNECGKAFSDRSHLIGHQRIHTGEKPYECNECGKAFSYKSVLIGHQRIHTGE
KPYECNECGKAFRWSISLALHERIHTGEKPYECNECGKTFQQKCNFAAHQRIHTGKKPYE
CNQCGKAFCSRSSFLHHQRIHTGEKPYECNECGKAFQRNSDVTTHQRIHTGEKPYECNQC
GKAFYSRSSFLHHQRIHTGEKPFQCNQCGKAFQRNSDLAAHQRIHTGEKPYECNQCGKAF
RYLSSLAKHQRIHTGEKPYECNQCGKAFTNSSSLATHQRTHTVEKPFECNQCGKTFRQNS
NLSIHQRIHTGEKPYECNQCGKTFRKTSHLAAHQRTHTGEKPYECNQCGKAFTRNSSLAT
HQRIHTGEKPYECNKCGKTFRQNSNLVAHQRIHTGEKLYECNKCGKTFRNNSHLVTHQRI
HTGEKPYECNQCGKTFTQSSHLIAHQTIRKKENSCDRGKAFQWNSSLSHQSENPC
Download sequence
Identical sequences F7DGL2
XP_007492402.1.35504 ENSMODP00000010637 ENSMODP00000010637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]