SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010900 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010900
Domain Number 1 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.46e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.29e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-22
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 9 Region: 613-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-19
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010900
Domain Number - Region: 201-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.032
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010900   Gene: ENSMODG00000023691   Transcript: ENSMODT00000011116
Sequence length 676
Comment pep:novel chromosome:BROADO5:3:499815455:499838257:-1 gene:ENSMODG00000023691 transcript:ENSMODT00000011116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGTPRPPFQGLITFKDVAVDFTQEEWCLLDHSQKELYLEVMLENVQNVLSVGLPVPRE
NLIYCFQPGKTPWLLEQKGPRISHSEAETNFEMKLSTKLSLFEDGSGPQRCMNEDPCGFI
LREICDSDIMVKKHAKTDSEFEDTAEKFSQYSVLNQYVKLTSENYFCQDNKHWKAFPEEV
GLVLSAEKPPEMPMNQDNLRGMAFGWISDLFRHQKHENIEMFFASDNGDRSFTQNSELAE
HQGIHTGEKPYECKHCGKAFTWKGALNAHQRIHTGEKPYKCKQCGNTFTWKSALIAHQSI
HTGEKPFECKYCGKAFTQRGHLTAHQRIHTGEKPYECKLCGKVFTYRCSLTTHQRIHTGE
KPYECKLCGKVFTHRCSLTIHQSIHTGEKPYECKDCGKVFTWKFSLTTHQRIHTGEKPYE
CKLCGKAFRNRSHLATHQRIHTGEKPYECKQCGKAFTEKCSLTTHQRIHTGEKPFECKQC
GKAFKEMGNLAAHQKTHTGVKPYECKHCGKAFTRKVSFSTHQRIHTGEKPFECKHCGKAF
TWKSCLTAHQSIHTGEKPFECKQCGKTFTRKDHLAKHQRIHSGEKPYECKDCGKTFTQRD
YLATHQRIHTGEKPYECKQCGKAFTRKGYLAAHEIIHTGEKPYKCKHCGKAFTWKGYLTA
HQSIHTGMKAFEYKHS
Download sequence
Identical sequences F6RGZ4
ENSMODP00000010900 ENSMODP00000010900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]