SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010981 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010981
Domain Number 1 Region: 229-346
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000532
Family N-acetyl transferase, NAT 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010981
Domain Number - Region: 127-137
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0602
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010981   Gene: ENSMODG00000008821   Transcript: ENSMODT00000011197
Sequence length 391
Comment pep:known_by_projection chromosome:BROADO5:5:301545678:301563538:1 gene:ENSMODG00000008821 transcript:ENSMODT00000011197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRMTLVKGRDMVGLRFWGGIRSEENSPISPTGKLRLADQGLRRLGFGVGTEAVVAMAID
AGGQEGLEEGLARDVTERAPPPPLAPLNLIGARPPVAVVRRRGLGTARGEGAGAAHARCG
PRRCLVPPPLPPLPPPPFRRRVCEGGAGAGAGAAATAATMGRKSSKAKEKKQKRLEERAA
MDAVCAKVEAANKLEDPLEAFPVFKKYDRNGLNVSIECKRVSGLEQATVDWAFDLTKSNM
QTLYEQSEWGWKDREKKEEMTDDRAWYLIAWEESAVPVAFSHFRFDVECGDEVLYCYEVQ
LESKVRRKGLGKFLIQILQLVANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSM
SGCCGDDCSYEILSRRTKFGDSQHAHSGSQI
Download sequence
Identical sequences F6Q9B3
ENSMODP00000010981 ENSMODP00000010981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]