SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010989 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010989
Domain Number 1 Region: 18-59
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000000164
Family MYND zinc finger 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010989
Domain Number - Region: 128-133
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 214-408
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0796
Family PhyH-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010989   Gene: ENSMODG00000008825   Transcript: ENSMODT00000011205
Sequence length 438
Comment pep:known_by_projection chromosome:BROADO5:2:160264306:160338856:1 gene:ENSMODG00000008825 transcript:ENSMODT00000011205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANDSGGAGGLSPSERDRQYCELCGKMENLLRCSRCRSSFYCSKEHQRQDWKKHKLVCHG
GEHGPGGGGRPQPQPPGASHPATPSKASRARLKEGKKAPQQQQQQRPPPPHRDTTSPEAV
AGTGAVLPPPPPPAAVVSAAAAPPPPAAVNNQGPVAGPGEAEPGKDELLGRSPLCPGGCP
QLSPPSLGLMLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGEEVRA
LHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGRLMSSMDDLIRHCNGKLG
NYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPE
GKAQFADIEPKFDRLLFFWSDRRNPHEVQPAFATRYAITVWYFDADERARAKVKYLTGEK
GVRVELNKPSDSIGKDVL
Download sequence
Identical sequences F6XVI0
ENSMODP00000010989 ENSMODP00000010989 13616.ENSMODP00000010989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]