SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011032 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011032
Domain Number 1 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 232-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011032   Gene: ENSMODG00000008860   Transcript: ENSMODT00000011249
Sequence length 495
Comment pep:novel chromosome:BROADO5:3:522106775:522166922:-1 gene:ENSMODG00000008860 transcript:ENSMODT00000011249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRTPRPPSQGSITFKDVAVDFTQEEWCLLDHSQKALHLEVMLENVQNLLSVGLPVPRE
NFISCFQQGKAPYLLQRNGPKSSSPEAENNYGVKASSTKVSPFVEGSGPQQCMNENLYDF
LLRESCDSAIKVNKNLKSDSEFDETEEKFSQYSVLTEYMKMTSGNDYCQDREYRKRFREK
GGLIQSPEKPEKPLYQSNVGGMALGYSSNIIRHSKSKHVEMVSMNDKGGRPFSQNSQLDT
HQQIHSREKSYECKHCGKAFKKRGYLAKHQSIHTGQKPYECKQCGKVFRERRSLVKHQSI
HTGEKPFECKQCGKAFRERRSLDKHQSVHTGVKPYKCKHCGKTFSHRSNLAAHQSIHSGE
KPYQCKHCGKAFTQRGNLTSHERIHTGEKPYECQQCGKVFTWSASLAAHQSIHTGDKPYD
CQHCGKAFTQKCSLSRHQKTHTRKKTLECNQYGNAFIETDHLTRAQSIQAVDKLLLYRVT
SCFILQNASNRITNL
Download sequence
Identical sequences F7CUA9
ENSMODP00000011032 ENSMODP00000011032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]