SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011047 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000011047
Domain Number - Region: 29-37
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00863
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011047   Gene: ENSMODG00000008869   Transcript: ENSMODT00000011264
Sequence length 491
Comment pep:novel chromosome:BROADO5:X:3263549:3274450:1 gene:ENSMODG00000008869 transcript:ENSMODT00000011264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARSRTAELKVMAGASAARPPASSPSSPPPPPPPPQLLLLLLALLLAAAATAAEQQVP
LVLWSSSRDLWVPLENAHEGHITTDGQLASYLDPALEKGPRNVLLFLQEKLSIEDFTTYG
GVFGNKQDSAFSNLENTLDLAPSSLILPSVDWYAASTLTSYLKEKLGASPLHVDQATLRE
LKLNDSLPALLLLRLPYTTSSGLMAPKEVLTGNDEIIGQVMNTLKAEGVPYTAILTAVQP
SRVIRDLSSMVSGGLGRHLLGENEDFKPEPSPSLPLPPVSYNDTEPRILFWAQNFTVTYN
NELRDLTALTFGNPALNLSSSSWNSSFAQLAMTYENVFGSFLTIKLILNNRLYPVSARSW
FTMDRLEIHVNNSVVVFNSSHITAPSIYSFHCEYVSTERSKNSLLVALPGSSAWHVTFQD
FQIQAFNLSGGNFSYASDCASFFSPGIWMGLVSSLIMLFIFTYGLHMILNLKTMDRFDDH
KGSTLSVPLTE
Download sequence
Identical sequences F7CAZ5
ENSMODP00000011047 ENSMODP00000011047 XP_001374281.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]