SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011165 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011165
Domain Number 1 Region: 40-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-16
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 214-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000156
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 131-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000427
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 177-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000436
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 87-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000552
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 264-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000108
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011165   Gene: ENSMODG00000008955   Transcript: ENSMODT00000011382
Sequence length 350
Comment pep:known_by_projection chromosome:BROADO5:4:297825213:297846791:1 gene:ENSMODG00000008955 transcript:ENSMODT00000011382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCEETDGSPAAPATASSSSLSIVRKKYFCSFPDCSATYNKAWKLDAHLCKHTGERPFV
CHYEGCGKAFIRDYHLNRHVLTHTGEKPFICTATGCDQKFNTKSNLKKHIDRKHENQQKQ
YLCDFEGCSKSFKKHQQLKVHQCQHTNEPLFKCNNKDCGKHFSSPSHLKRHEKIHEGYIC
QKGCSFVAKTWTELLKHMKETHKEEITCELCGKTFKRKDYLKQHKKIHAPERDVYRCPRE
GCGRSYTTVFNLQSHILSFHEEQRPFTCEHVGCGKSFAMKQSLTRHAVIHDPDKRKLKIK
VKRLSGKRSLASRLSGYIPPKIRETLPKSGKSSDCFEENMLSTVATLTLG
Download sequence
Identical sequences F7GCN9
ENSMODP00000011165 XP_007495318.1.35504 ENSMODP00000011165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]