SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011356 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011356
Domain Number 1 Region: 42-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 86-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000739
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011356   Gene: ENSMODG00000009106   Transcript: ENSMODT00000011576
Sequence length 176
Comment pep:known_by_projection chromosome:BROADO5:3:183939670:183951886:1 gene:ENSMODG00000009106 transcript:ENSMODT00000011576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGER
PYKCTQQDCTKAFVSKYKLLRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHNPNKEA
FKCEECGKNYNTKLGFKRHLALHAATSGDLTCKQPSLYTSFSTENLLIFIYLYRLT
Download sequence
Identical sequences F7FC94
ENSMODP00000011356 ENSMODP00000011356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]