SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011376 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011376
Domain Number 1 Region: 230-531
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.81e-88
Family Arginine methyltransferase 0.000000000189
Further Details:      
 
Domain Number 2 Region: 38-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.82e-36
Family variant C2H2 finger 0.00000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011376   Gene: ENSMODG00000009124   Transcript: ENSMODT00000011596
Sequence length 538
Comment pep:known_by_projection chromosome:BROADO5:5:256112783:256265718:1 gene:ENSMODG00000009124 transcript:ENSMODT00000011596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSLATGVTGVRPRLQEAEEEEEEVPGLSDSGDEVAWEDEEEEEEAEPPRDKQQTPCLFC
DRLFTSAEDTFSHCKSEHQFDIDNMVHKHGLEFYGYIKLINFIRLKNPTSEYLNSLCNPV
PWEKEEYLKPVLEDDLLLQFDVEDLYEPVTVPFSYPNGLSDNTSVLERLKHMEARAQSAE
AALARAREDLQRMKQFAQDFVMNADVRTNSSSTTTIADLNEDEDGVYFSSYGHYGIHEEM
LKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKQVIGVDQSEIIYQA
MDIIRLNKLEGIITLVKGRIEEVDLPVEKVDVIISEWMGYFLLFESMLDSVIYAKDKYLA
KGGSVYPDICSISLLAVGDPNKHADRIAFWDDVYGFNMSCMKKAVIPEAIVEVLDPKTII
SEPCGIKRIDCHAACVRDLEFSSDFTLKITKLSMCTAIAGYFDIFFEKNCHKKVLFSTGP
HTTQTHWKQTIFLLEKPFSVKAGEALKGKITIQKNRKDPRSLIVTLKLNNLTQTYSLQ
Download sequence
Identical sequences F7EYH0
XP_007497223.1.35504 ENSMODP00000011376 ENSMODP00000011376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]