SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011399 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011399
Domain Number 1 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.03e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.21e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 561-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 625-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 739-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 20-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 10 Region: 786-838
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.27e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 11 Region: 242-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-18
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 12 Region: 685-740
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-17
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011399   Gene: ENSMODG00000009921   Transcript: ENSMODT00000011619
Sequence length 845
Comment pep:novel chromosome:BROADO5:3:520786309:520804280:-1 gene:ENSMODG00000009921 transcript:ENSMODT00000011619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLEECGEGTGLEPCKTPHASVTFKDVAVDFTWEEWRLLDPPQKELFWEVMLENYRNLV
CLGLADSNKDVRISELESGEPHWIPTGGVLRSCWPGWESRPQNKESAPKMSISVKVLSQE
KFLEDDLRICKMAKAWECDGRLKKKQNIEGKPSRGIKIIQAEPPSEAGVSEHGKYLQTSS
PEPGLFPQQGTSEVHERENSFPRINECGPHQTTDRRKKCNELTKWRKTGRAEHYCHHQSR
ERRYNCSECGKAFQEKGHLKRHYRIHTGEKPFKCSECGKAFQEKEHLKRHNRIHTGEKPF
KCSECGKAFQQKGHLKIHYSIHTGEKPFKCSECGKAFQHKGALKIHYRIHTGEEPFKCSE
CGRAFHQKEHLKRHYRIHTGEKPFKCSECGKAFQQKGHLKIHYRIHTGEEPFKCSECGKA
FQHKGALKIHYRIHTGEEPFKCSECGRAFHQKGHLKRHYRIHTGEEPFKCSECGKAFQEK
GDLKIHYRIHTGEKPFKCSECGKAFQQKGDLKIHYRIHNGEKPFECSECGKAFQQKGDLK
IHYRVHTGEKPFKCSECGKAFQEKGDLKIHYRIHTGEKAFKCSECGKAFSRAGTLKRHQS
THTEEKPFDCNECGKTFRRNSHLLTFSGKYDLTTHTRIHAGEKPYECSECGKAFSSKSYF
THHSRIHAGEKPFQCDICGKVLLSKFNLNRHQKTHIEEKPFLYKCNECGKAFQEKGALKT
RYRIHTGEKPFKYRECGKAFSRSTSLTLHQRSHTGEKPYECNECGKAFWSSSHLSGHRRS
SHEGIRLHECSVCGKAFSRKYDLSNHSRIHTGEKPFKCSECGKAFYSNSDLTRHNRIHTR
KKSFQ
Download sequence
Identical sequences F7EFE5
ENSMODP00000011399 ENSMODP00000011399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]