SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011436 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011436
Domain Number 1 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 196-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.33e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 246-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 345-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-18
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 6 Region: 139-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000223
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011436   Gene: ENSMODG00000009165   Transcript: ENSMODT00000011656
Sequence length 404
Comment pep:novel chromosome:BROADO5:Un:79059269:79062548:1 gene:ENSMODG00000009165 transcript:ENSMODT00000011656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAQQVLMFQDVAVDFTGEEWRLLSPPQKELYKEVMLENARNLLSVDDCALMAHQENHLQT
IVDRFSTTTKLFGLMISLSKTESSTEPTPPASKSWSSEPSYDGLDTSSAWTHSEYQDRHS
MSDGLDKFASVQFCVAPQNSSDNEHQRMYTEEKSIESNMCRDTFMQRASLFGHQRMHTWE
KPYECKQCGRIFSHRSALVHQRIHTGEKPYECKQCGKTFTQSSGLASHQRVHTGEKSYEC
KQCQKTFSHTSSLTVHQRMHTGEKPYECKQCGKTFHYRSALAVIHTGKKPYECKQCGKTF
SHTSCLTVHHRVHTGEKPYECKECGRTFSHSSGLVVHQRIHTGEKPYKCKQCGKTFIQSF
NLAHHHRLHTREKPYECKQCGKTFGHISSLSIHQRMHTGEKPYE
Download sequence
Identical sequences H9H6A9
ENSMODP00000011436 13616.ENSMODP00000011436 ENSMODP00000011436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]