SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011441 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011441
Domain Number 1 Region: 363-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000203
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 2 Region: 308-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000167
Family Classic zinc finger, C2H2 0.00087
Further Details:      
 
Domain Number 3 Region: 333-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000182
Family Classic zinc finger, C2H2 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011441
Domain Number - Region: 428-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0011
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011441   Gene: ENSMODG00000009168   Transcript: ENSMODT00000011661
Sequence length 486
Comment pep:known_by_projection chromosome:BROADO5:2:250031094:250043409:1 gene:ENSMODG00000009168 transcript:ENSMODT00000011661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLGSQRQKRRELDARRSKCRIRLGGHMEQWCLLKKQLGFSLHSQLAKFLLDRYNSPG
CVLCAGPEPSIPQGLQYLVFLSHAHSRECSLVPGLRGPGSTEAGLVWECSAGHTFSWDPS
SGPAPQGSSPSYIQHSALRNWWTKSGSWQEHEAQVTEHYDGTQESGIPRGVAPLPETTLP
HGEEEEEVEEDVDDEDDVSDVSPWTYSPSPDCSELGASSPLPSHLPPLKEETTPPSSSSP
HADSSETGTPHPEEERDQPELDRIPQLSQENKTGPRRRRQGPPPMPLDEDIAQIGPKRIR
KAAKRELLPCDFPGCGKIFSNRQYLNHHKKYQHIHQKSFSCPEPSCGKSFNFKKHLKEHV
KLHSDTRDYICEFCARSFRTSSNLIIHRRIHTGEKPLQCEICGFTCRQKASLNWHRRKHE
EAAAAFQYPCEFCGKRFEKPDNVIAHCSKSHPVPRPGPDSSPTLSEPHTSPTISSSTPTI
SESSLS
Download sequence
Identical sequences F7ADJ4
XP_007483115.1.35504 ENSMODP00000011441 ENSMODP00000011441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]