SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011460 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011460
Domain Number 1 Region: 639-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000413
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 
Domain Number 2 Region: 672-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000901
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011460   Gene: ENSMODG00000009184   Transcript: ENSMODT00000011680
Sequence length 785
Comment pep:known_by_projection chromosome:BROADO5:4:184653847:184701914:-1 gene:ENSMODG00000009184 transcript:ENSMODT00000011680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPEKPVKQEEMAALDVDSGGGGGGSGGHGEYLQHGNGAAAAAAAAAAAAAAQDTQPSP
LALLAATCSKIGPPLPDDEEEPAAAGNHPAGATGDLTSVQLGETPNRWEVLPATSTNIKD
EAGNIVQIPGTTTVTSSGQYVLPLQSLQNQQIFSVASGSDSSNGTVSNVQYQVIPQIQTT
DGQQVQIGFTGSSDNGSINQESGQIQIIPGSNQTLLASGTPSSNIQNILSQTGQVQVQGV
TIGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLSSSSQTMTAGINADGHLINT
GQAMDSSDNSERTGDRVSPEISETNTDTDLFVPTSSSSQLPVTIDSSGILPQNTNSLTTS
GSQVHSSDLQGNYIQSSVSDETQTQNIQVSTAQPIVQHLQLQESQQPTSQAQIVQGLTPQ
TIHGVQAGGQSISQQALQNLQLQLNPGTFLIQAQTVTPSGQITWQTFQVQGVQNLQNLQN
LQIQNTSAQQITLTPVQTLTFGQVAAGGALTSTPVSLSTGQLPNLQTVTVNSIDSTGIQL
HSGENADSPADIRIKEEEPDPEEWQLSGDSTLNTSDLTHLRVQVVDEEGDQPHQEGKRLR
RVACTCPNCKEGGGRGANLGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWV
FCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVL
ASVEASRDETLITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQLVTVSG
NETME
Download sequence
Identical sequences F6ZNM7
ENSMODP00000011460 XP_007494455.1.35504 ENSMODP00000011460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]