SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011609 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011609
Domain Number 1 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 11-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 545-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.03e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 642-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 11 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-16
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 12 Region: 451-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000197
Family Classic zinc finger, C2H2 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011609   Gene: ENSMODG00000009291   Transcript: ENSMODT00000011829
Sequence length 699
Comment pep:novel chromosome:BROADO5:3:509527030:509536667:-1 gene:ENSMODG00000009291 transcript:ENSMODT00000011829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGLPPARLRQEPLTFRDVAVDFTREEWRYLHPSQKDLYRDVMLENYRNLVCLGLAVAK
PDMIYRLERGEKPWLQEDAVPRSTCPSWKDRLESGQSVPKLDISLDELGQEILVRNGSCA
SKLRQIRKCDVQLERQRSNKEKSHECNGCDKAVSQGTHLTRHRKIRTGEKPYECSECGKA
FNQKRDLAQHQRIHTGDKPYTCNQCGKAFRHRTVLIGHQRVHNGEKPYECSECGKAFNQK
RDLAQHQRIHTGDKPYTCNQCGKAFRHRTVLIGHQRVHNGEKPYECSECGKAFNQKRDLA
QHQRIHTGDKPYTCNQCGKAFRHRTVLIGHQRVHNGEKPYECSECGKAFNQKRDLAQHQR
IHTGDKPYTCNQCGKAFRHRTVLIGHQRVHNGEKPYECSECGKSFTWRAYLTRHQRVHTG
EKPFKCNECGKAFVQKKGLTRHQRIHTGEKPYECKECGKAFCRSTDFTQHQRVHTGEKPF
ECKECGKAFNRSTHLTQHQRIHTGDKPHQCTQCGKAFFHVKELDRHQRIHTGEKPYECTE
CGKAFFEKKELTRHQQIHNGEKPYLCVECGKSFLRKAHLLVHQRVHTAEKPYECNKCGKA
FFQSSDLNLHQRVHTGEKPYECNECGKTFFLNTALNLHRRLHTGEKPYECNECGKSFIRR
TYLTRHQRAHNGEKPYECNKCEKSFTRRTNLIKHQKVHT
Download sequence
Identical sequences F6YXK1
ENSMODP00000011609 XP_007490408.1.35504 ENSMODP00000011609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]