SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011613 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011613
Domain Number 1 Region: 187-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 2 Region: 223-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000128
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 515-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000222
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011613
Domain Number - Region: 167-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0373
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011613   Gene: ENSMODG00000009274   Transcript: ENSMODT00000011833
Sequence length 574
Comment pep:known_by_projection chromosome:BROADO5:6:267431038:267563038:-1 gene:ENSMODG00000009274 transcript:ENSMODT00000011833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHWNEEVEWRGEGPRAELPPAAAALLRGGAAAHGAGEDWESCLLPAPAKADNLRKMETD
EAQDMSQVSGKESPSGSDVPDDSDEPMPVPEDLSTTSGGQQNSKNERVLASNVKIETQSD
EENGRACEMNGEECAEDLRMLDTSGEKMNGSHNGQGSKALSGVGGIRLPNGKLKCDICGI
ICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRR
RDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLQSMGLPATLYPVIKEET
NHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFVGEKCLPDIPYDASANYEKENE
MMQTHVMDQAINNAISYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPHADGHPRPNHT
AQDSAVENLLLLSKAKSISSERDASPSNSCQDSTDTESNNEERSGLIYLTNHINPHARNG
LSIKEEHRPYDVLRAATDNSQDAFKVISNSGEPMKVYKCEHCRVLFLDHVMYTIHMGCHG
FRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS
Download sequence
Identical sequences F6YXG9
ENSMODP00000011613 XP_007500468.1.35504 ENSMODP00000011613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]