SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011625 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011625
Domain Number 1 Region: 345-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 378-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000152
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011625   Gene: ENSMODG00000009303   Transcript: ENSMODT00000011845
Sequence length 485
Comment pep:known_by_projection chromosome:BROADO5:4:185285297:185289008:1 gene:ENSMODG00000009303 transcript:ENSMODT00000011845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSILGEEPRFGTTPLAMLAATCNKIGNTSPLTTLPESSAFAKGGFHPWKRSTSSCNLG
SSLSGFAVATSSRGSSGLAGGSGAANSAFCLASTSPTSSAFSSDYGGLFSNTAAAAAAAA
GVSPQEAGGQSAFISKVHTSAADSLYPRVGMAHPYESWYKSGFHSTLAAGEVTNGAASSW
WDVHTNPGSWLEVQNPAGGLQSSLHSGAPQASLHSQLGTYNPDFSSLTHSAFSSTGLGSS
AAAASHLLSTSQHLLTQEGFKPVLPSYTDSSAAVAAAASAMITGAAAAAAGGSSARSARR
YSGRATCDCPNCQEAERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERP
FVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHIKTHNGGGGGK
KGSDSDTDASNLETPRSESPDLILHDSGVSAARAAAAAAAAAAAAAAAAAASAGGKESTS
GPNDS
Download sequence
Identical sequences F6YX28
ENSMODP00000011625 ENSMODP00000011625 13616.ENSMODP00000011625 XP_001368274.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]