SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011787 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011787
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily POZ domain 4.45e-23
Family BTB/POZ domain 0.0071
Further Details:      
 
Domain Number 2 Region: 236-260,344-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000363
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011787   Gene: ENSMODG00000009433   Transcript: ENSMODT00000012010
Sequence length 411
Comment pep:known_by_projection chromosome:BROADO5:1:267145687:267164614:-1 gene:ENSMODG00000009433 transcript:ENSMODT00000012010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTASHSLVLLQQLNMQREFGFLCDCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQTSEC
IKIQPTDIQPDIFSYLLHIMYTGKGPKQTVDHGRLEEGIRFLHADYLSHIATEMNQVFSP
ETVQSSNLYGIQISTTQKTTTKEGLEMKENPSNSNGNRNIAQGDHPQLQLSLAIGLDDGT
PDQQISHTSSQAMDELQKPPVSIKQERCDPESVVSQSHPSPSSEVTGPTFTESGIKIHLC
HYCGERFDSRGNLREHLHTHVSGSLPFGVPASILESNDLGEVHPIGESSEALECHRLNTF
LVKENEQQPDHLNRGTMEPLQISQLSLISKDTEPVELNCNFSFSRKRKIGCTVCGHKFLR
KSQLLEHMYIHKGMTGSFTLSSKILKAKRLHLQSGSGKALLTPFYRKNPKT
Download sequence
Identical sequences F7BKQ1
ENSMODP00000011787 ENSMODP00000011787 XP_007473059.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]