SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011846 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011846
Domain Number 1 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.37e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 398-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-16
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011846   Gene: ENSMODG00000009474   Transcript: ENSMODT00000012069
Sequence length 473
Comment pep:novel chromosome:BROADO5:4:405963211:405968665:-1 gene:ENSMODG00000009474 transcript:ENSMODT00000012069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITLRDVVMDFTQEEWCLLDHAQKELYREVMLENVWNLQSVETNFEVKEMCNNLSLFVEGS
DPQRCMNESPCDFILREICDADIRVNKIPMSDYEFDETAEKFSQYSVLNQYMKLTFGNYS
SRDSEYSRCFPEEEEFIQLPEKPPEMLMYQGNLAEMAFDCSSDLISHPKSKCIEMLTVNN
KVGRPFRPNSELGSHQICHSGEKKLYECNQCGKAFTISTNLTRHQRIHTGEKPYECKQCG
KTFTRKCHLARHFRIHTGEKPYECKQCGKAFPRRSRLAAHQRTHNGEKPYECKQCGKTFT
EKGSLGVHQRTHTGEKPYECMQCGKAFINKSDLYKHQRVHTIEKPYECTQCGKAFTRRDQ
LASHQTIHTGEKPYECKQCGKAFKHKGSLIVHVRNHTGEKPYECKQCGKAFTKNSSLGAH
QRIHTGEKPYKCRTCGKAFRNISHLHKHQRVHTSEKPYEMWYGLQAIIMFPTE
Download sequence
Identical sequences F7FNJ1
13616.ENSMODP00000011846 ENSMODP00000011846 ENSMODP00000011846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]