SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011852 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011852
Domain Number 1 Region: 271-571
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.95e-66
Family Enolase 0.00021
Further Details:      
 
Domain Number 2 Region: 65-162,222-263
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.47e-24
Family Enolase N-terminal domain-like 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011852
Domain Number - Region: 191-201
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00523
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011852   Gene: ENSMODG00000009486   Transcript: ENSMODT00000012075
Sequence length 619
Comment pep:known_by_projection chromosome:BROADO5:1:93085447:93261399:-1 gene:ENSMODG00000009486 transcript:ENSMODT00000012075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGGGGRNDAHELYKLKQRAVEYYRMNDVPRQLEDLLNSTFYLQPPDVYGHLANCFTKL
SKAPTIYKVIGRVVLDGMGHQTLRVEIFCTIQNQVKSITSAVISSHFEVLETAMPDTVDA
VELERNEAISVAVQWVNESMTELLEGLEPTQQEVADQLLTNFFANKLQEDKESKELELSL
QQPLSLMSLQPPSPPPPPPPPSKKKGQKGKKEVIPEKPIPPAEPPEPVLHGSMAIGAVSL
AVAKTCAILSNTPLYLNIASLKYKRESPRTLSLPLLMITMLSCGKSSPGKLNLMKEVICI
PHPGLTVQQGITMLLEIQKQIIKIIDKPHTPKPETKKGHNGKKGGSTQIVGKLSYIGCLS
INYDTIEQPLLLLQGICGNLGLELGINLYLAINCAAHEFIDYTRGKYEVMTGVFKNPAEM
VDIYVELINKFPSITALIDPVRKEDSEQWDSICNALGSRCNIIAGTAAKSIPKLLEEKNL
STPKCSGLIIKHTNQTTMSDLAEVTKLIESQKRIAILGSTEGESSDDSLADLAVGLGVRF
LKLGGLSRGERMTKYNRLFAIEEELVQGGTLVPSVGQTFIDFEEEALKAAEAPGATLSST
DAEIPHGTPPFSVTSETMK
Download sequence
Identical sequences F7FN99
ENSMODP00000011852 ENSMODP00000011852 XP_007478995.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]