SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011897 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011897
Domain Number 1 Region: 40-170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-17
Family Nucleotide and nucleoside kinases 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011897
Domain Number - Region: 16-25
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00238
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011897   Gene: ENSMODG00000009524   Transcript: ENSMODT00000012121
Sequence length 241
Comment pep:known_by_projection chromosome:BROADO5:4:304203517:304227444:-1 gene:ENSMODG00000009524 transcript:ENSMODT00000012121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESFLHSFRSLSLQPPPPPQPPPPARRRPQRRGSFRKQLYLLRGLPGSGKSTLARQLKH
DFPRALIFSTDDFFFKEDGTYEFNPDVLEEAHDWNQRRARKAMRNGTSPIIIDNTNLHAW
EMKPYAVMALENNYEVIFREPDTRWKFNVQELARRNTHGVPREKIHRMKEQYEHDVTFHS
VLHAEKPSRMHRSQDRHMPPPPPFNSAGYWNPYSGFPNRRAPGGFPHDSYFNRRGGYYNG
Y
Download sequence
Identical sequences F7EUZ2
ENSMODP00000011897 13616.ENSMODP00000011897 XP_001367570.1.35504 ENSMODP00000011897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]