SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011914 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011914
Domain Number 1 Region: 140-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 117-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000547
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011914
Domain Number - Region: 211-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0276
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011914   Gene: ENSMODG00000009534   Transcript: ENSMODT00000012138
Sequence length 267
Comment pep:known_by_projection chromosome:BROADO5:8:13377188:13384304:-1 gene:ENSMODG00000009534 transcript:ENSMODT00000012138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAFLVKKPCVSTGKRNWSELPDEERGEIYVPVSLGFCPPQPYHDLEPSVAEPPSCPLA
LDMSLREPGYGAAPGPCVVAQLPAEDMGCLTDSQAHDHGFLRPKIKVTMGDSPSGDLFTC
HICHKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCD
KAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSDSQEGHVLHLKEHHPDSP
LLRKTSKKGAGALQNTVTALLQNNHHL
Download sequence
Identical sequences F7C4B4
ENSMODP00000011914 XP_001379608.1.35504 XP_016280863.1.35504 ENSMODP00000011914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]