SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011935 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011935
Domain Number 1 Region: 143-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000976
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 
Domain Number 2 Region: 73-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000115
Family HkH motif-containing C2H2 finger 0.005
Further Details:      
 
Domain Number 3 Region: 4-51
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000238
Family HkH motif-containing C2H2 finger 0.0045
Further Details:      
 
Domain Number 4 Region: 205-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000223
Family HkH motif-containing C2H2 finger 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011935   Gene: ENSMODG00000009552   Transcript: ENSMODT00000012159
Sequence length 238
Comment pep:novel chromosome:BROADO5:1:716577407:716587974:1 gene:ENSMODG00000009552 transcript:ENSMODT00000012159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLDEHKRNDLFTDNFCKVCGAVLQFESQRISHYEGKKHAQKVRLYFQIHGEQNEAQVPDK
KVKLDFLSLQVIVDKNKFCDLCNMIFSSPVVAQSHYLGKVHAKKLKQLMGEHAQTSPPRP
EPQQPASERAAPEAATEEAPPSSGGPTLDLNDPDRYCELCCASFNSPLMAQQHYVGKKHK
RSEARKKILEEIGQKTLPAESTSSALGVGHYICPICSITLTSIEMYQSHMQGNKHQIK
Download sequence
Identical sequences F7BJY8
13616.ENSMODP00000011935 ENSMODP00000011935 ENSMODP00000011935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]