SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011968 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011968
Domain Number 1 Region: 8-253
Classification Level Classification E-value
Superfamily SET domain 5.89e-38
Family Histone lysine methyltransferases 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011968   Gene: ENSMODG00000009578   Transcript: ENSMODT00000012192
Sequence length 490
Comment pep:known_by_projection chromosome:BROADO5:1:716506826:716539416:-1 gene:ENSMODG00000009578 transcript:ENSMODT00000012192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIGRMEKVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSFTQVVCHTCFKRQE
KLQRCGQCKFAHYCDRTCQKDAWLNHKHECAAIKKHGKPPSENIRLAARIMWRIEREGTG
LTEGCLVSVDDLQNHVDNFGEEEQKDLRVDVDSFLNFWPAQSQQFSMQYISHIFGVINCN
AFTLSDQRGLQAVGVGIFPNLCLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALG
KISEGEELTVSYVDFLNVSQERKKQLKKQYYFDCTCEHCEKGIKDDLFLAVKADPKPSQD
VVKEVTQFSKETLEKIDKARSEGLYHEVVKLCRECLQKQEPVLADTNIHVLRILSIASEV
LSYLQSFHEASDYAKRMVDGYMKLYHPNNAQLGMAVMRAGLTHWHAGLIEAGHGMICKAY
AILLVTHGPTHPITKDLEAMRIQSEMELRMFRQNEFMYHKMREATLSNQKMQVMAEPNLE
TATPTFLKKP
Download sequence
Identical sequences F7AX16
ENSMODP00000011968 13616.ENSMODP00000011968 XP_001379366.1.35504 ENSMODP00000011968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]