SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011982 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011982
Domain Number 1 Region: 267-341
Classification Level Classification E-value
Superfamily Homeodomain-like 2.44e-25
Family Homeodomain 0.0000234
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011982
Domain Number - Region: 253-272
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0575
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011982   Gene: ENSMODG00000009591   Transcript: ENSMODT00000012206
Sequence length 348
Comment pep:known_by_projection chromosome:BROADO5:4:187463911:187466684:1 gene:ENSMODG00000009591 transcript:ENSMODT00000012206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSGTLSNYYVDSLIGHESDEVYAGRFGQAGHGTATRPSGVADGAEFSSCSFAPKSTVF
SASWPTVPPQPSAAMTGIYHPYVHQPHLAASEPSRYVRSWIEPFPSFPSSSTGSSGTGSS
SGGGGGGGGGGGGGTSSTGRHYGIKPETGVAPATSSSSSSSSSSSSSSSSSCPSSSTSSS
SSTKRTECSSSRESQGISVPEYTCNSFLQEPREKSAATAATAAAGVAGVANGKDPSACSD
HPSPSSQLKEEKQQQQQQQQQQQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLELEKEF
LFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNKEKGSKGD
Download sequence
Identical sequences F7A9F7
XP_001368526.1.35504 ENSMODP00000011982 ENSMODP00000011982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]