SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012055 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012055
Domain Number 1 Region: 332-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000211
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 3 Region: 56-66
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000732
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012055   Gene: ENSMODG00000009646   Transcript: ENSMODT00000012279
Sequence length 447
Comment pep:known_by_projection chromosome:BROADO5:5:268102831:268165744:-1 gene:ENSMODG00000009646 transcript:ENSMODT00000012279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLSAPAPPPAP
PPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQPPS
GQARMFPNAPYLPSCLESQPTIRNQVHFSFTFCSTDSFHSQSTWSLLGPGGSVLWEKNFL
QKGKVGCEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYNSDNLYQMTSQLECMTWNQMN
LGATLKGPAAGNSSSLKWTEGQSNHTTGYENDNHTTPILCGAQYRIHTHGVFRGIQDVRR
VPGVAPTIVRSATETNEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCER
RFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQ
KKFARSDELVRHHNMHQRNMTKLQLTL
Download sequence
Identical sequences F6QTA6
13616.ENSMODP00000012055 ENSMODP00000012055 ENSMODP00000012055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]