SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012082 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000012082
Domain Number - Region: 104-181
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0544
Family Cytochrome c3-like 0.028
Further Details:      
 
Domain Number - Region: 4-14
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012082   Gene: ENSMODG00000009665   Transcript: ENSMODT00000012306
Sequence length 254
Comment pep:known_by_projection chromosome:BROADO5:8:13515577:13517419:-1 gene:ENSMODG00000009665 transcript:ENSMODT00000012306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPPPPPPPLSPPRVAERAVTSLPEPQSKSSDRGAGAYVTSGAVFVSGGNGDMALNGAE
AGESDWEPPSEAETKVLQARRERQDRISRLMGDYLLCGYRMLGDTCQDCGTILLQDKQRK
TYCVACQELNSDVDKDNPALNAQAALSQAREHQLASSELPTASRPAPQPPVPRPEHCEGA
AAGLRAAQGPSPTLAPTASLAPDVLATSQSALLQKLAWASGELGPSTSLEGSIQLCTLIR
VCAEALQGIRQLQQ
Download sequence
Identical sequences F6SHT3
ENSMODP00000012082 ENSMODP00000012082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]